Recombinant Human MORF4L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MORF4L1-5758H
Product Overview : MORF4L1 MS Standard C13 and N15-labeled recombinant protein (NP_006782) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.
Molecular Mass : 37.2 kDa
AA Sequence : MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MORF4L1 mortality factor 4 like 1 [ Homo sapiens (human) ]
Official Symbol MORF4L1
Synonyms MORF4L1; mortality factor 4 like 1; mortality factor 4-like protein 1; Eaf3; Esa1p associated factor 3 homolog (S. cerevisiae); HsT17725; MEAF3; MORF related gene on chromosome 15; MORFRG15; MRG15; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15; FWP006; S863-6; MGC10631;
Gene ID 10933
mRNA Refseq NM_006791
Protein Refseq NP_006782
MIM 607303
UniProt ID Q9UBU8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MORF4L1 Products

Required fields are marked with *

My Review for All MORF4L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon