Recombinant Human MORF4L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MORF4L1-5758H
• Product Overview: MORF4L1 MS Standard C13 and N15-labeled recombinant protein (NP_006782) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.
• Molecular Mass: 37.2 kDa
• AA Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MORF4L1 mortality factor 4 like 1 [ Homo sapiens (human) ]
• Official Symbol: MORF4L1
• Synonyms: MORF4L1; mortality factor 4 like 1; mortality factor 4-like protein 1; Eaf3; Esa1p associated factor 3 homolog (S. cerevisiae); HsT17725; MEAF3; MORF related gene on chromosome 15; MORFRG15; MRG15; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15; FWP006; S863-6; MGC10631
• Gene ID: 10933
• mRNA Refseq: NM_006791
• Protein Refseq: NP_006782
• MIM: 607303
• UniProt ID: Q9UBU8