Recombinant Human MORF4L1 Protein, GST-tagged
Cat.No. : | MORF4L1-5477H |
Product Overview : | Human MORF4L1 full-length ORF ( AAH22845, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MORF4L1 (Mortality Factor 4 Like 1) is a Protein Coding gene. Diseases associated with MORF4L1 include Paraneoplastic Cerebellar Degeneration. Among its related pathways are Chromatin organization and Chromatin Regulation / Acetylation. GO annotations related to this gene include chromatin binding and protein N-terminus binding. An important paralog of this gene is MORF4L2. |
Molecular Mass : | 61.27 kDa |
AA Sequence : | MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MORF4L1 mortality factor 4 like 1 [ Homo sapiens ] |
Official Symbol | MORF4L1 |
Synonyms | MORF4L1; mortality factor 4 like 1; mortality factor 4-like protein 1; Eaf3; Esa1p associated factor 3 homolog (S. cerevisiae); HsT17725; MEAF3; MORF related gene on chromosome 15; MORFRG15; MRG15; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15; FWP006; S863-6; MGC10631; |
Gene ID | 10933 |
mRNA Refseq | NM_006791 |
Protein Refseq | NP_006782 |
MIM | 607303 |
UniProt ID | Q9UBU8 |
◆ Recombinant Proteins | ||
MORF4L1-3727R | Recombinant Rat MORF4L1 Protein | +Inquiry |
MORF4L1-5758H | Recombinant Human MORF4L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Morf4l1-4114M | Recombinant Mouse Morf4l1 Protein, Myc/DDK-tagged | +Inquiry |
MORF4L1-3288C | Recombinant Chicken MORF4L1 | +Inquiry |
MORF4L1-15834H | Recombinant Human MORF4L1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORF4L1-4252HCL | Recombinant Human MORF4L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MORF4L1 Products
Required fields are marked with *
My Review for All MORF4L1 Products
Required fields are marked with *
0
Inquiry Basket