Recombinant Human MORC3 Protein, His-SUMO-tagged
Cat.No. : | MORC3-1284H |
Product Overview : | Recombinant Human MORC3 Protein (1-290aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-290 a.a. |
Description : | This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | MORC3 MORC family CW-type zinc finger 3 [ Homo sapiens (human) ] |
Official Symbol | MORC3 |
Synonyms | NXP2; ZCW5; ZCWCC3; nuclear matrix protein 2; nuclear matrix protein NXP2; zinc finger CW-type coiled-coil domain protein 3; zinc finger, CW type with coiled-coil domain 3 |
Gene ID | 23515 |
mRNA Refseq | NM_015358.2 |
Protein Refseq | NP_056173.1 |
MIM | 610078 |
UniProt ID | Q14149 |
◆ Recombinant Proteins | ||
MORC3-1284H | Recombinant Human MORC3 Protein, His-SUMO-tagged | +Inquiry |
MORC3-1423H | Recombinant Human MORC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MORC3-55HFL | Active Recombinant Full Length Human MORC3 Protein, C-Flag-tagged | +Inquiry |
MORC3-186H | Recombinant Human MORC3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MORC3-4600C | Recombinant Chicken MORC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORC3-1129HCL | Recombinant Human MORC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MORC3 Products
Required fields are marked with *
My Review for All MORC3 Products
Required fields are marked with *
0
Inquiry Basket