Recombinant Human MORC1 Protein, GST-tagged

• Cat.No.: MORC1-5475H
• Product Overview: Human MORC1 partial ORF ( NP_055244, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the human homolog of mouse morc and like the mouse protein it is testis-specific. Mouse studies support a testis-specific function since only male knockout mice are infertile; infertility is the only apparent defect. These studies further support a role for this protein early in spermatogenesis, possibly by affecting entry into apoptosis because testis from knockout mice show greatly increased numbers of apoptotic cells. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MORC1 MORC family CW-type zinc finger 1 [ Homo sapiens ]
• Official Symbol: MORC1
• Synonyms: MORC1; MORC family CW-type zinc finger 1; microrchidia (mouse) homolog , microrchidia homolog (mouse) , MORC; MORC family CW-type zinc finger protein 1; cancer/testis antigen 33; CT33; ZCW6; microrchidia, mouse, homolog of; MORC
• Gene ID: 27136
• mRNA Refseq: NM_014429
• Protein Refseq: NP_055244
• MIM: 603205
• UniProt ID: Q86VD1