Recombinant Human MOG protein, His-tagged
Cat.No. : | MOG-4405H |
Product Overview : | Recombinant Human MOG protein(Q16653)(30-154aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-154aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MOG myelin oligodendrocyte glycoprotein [ Homo sapiens ] |
Official Symbol | MOG |
Synonyms | MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137; |
Gene ID | 4340 |
mRNA Refseq | NM_001008228 |
Protein Refseq | NP_001008229 |
MIM | 159465 |
UniProt ID | Q16653 |
◆ Recombinant Proteins | ||
MOG-633H | Recombinant Human MOG Protein, His-tagged | +Inquiry |
MOG-4583H | Recombinant Human MOG Protein (Gly30-Gly154), C-His tagged | +Inquiry |
MOG-3593H | Recombinant Human MOG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mog-6366M | Recombinant Mouse Mog protein, His-tagged | +Inquiry |
Mog-01M | Recombinant Mouse Mog Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *
0
Inquiry Basket