Recombinant Human MMRN1 Protein, GST-tagged

• Cat.No.: MMRN1-5439H
• Product Overview: Human MMRN1 partial ORF ( NP_031377, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MMRN1 multimerin 1 [ Homo sapiens ]
• Official Symbol: MMRN1
• Synonyms: MMRN1; multimerin 1; MMRN, multimerin; multimerin-1; ECM; EMILIN4; glycoprotein Ia*; GPIa*; EMILIN-4; endothelial cell multimerin; elastin microfibril interfacer 4; elastin microfibril interface located protein 4; MMRN
• Gene ID: 22915
• mRNA Refseq: NM_007351
• Protein Refseq: NP_031377
• MIM: 601456
• UniProt ID: Q13201