Recombinant Human MMP7 protein, GST-tagged

• Cat.No.: MMP7-3236H
• Product Overview: Recombinant Human MMP7 protein(P09237)(95-267aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 95-267aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.1 kDa
• AA Sequence: YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ]
• Official Symbol: MMP7
• Synonyms: MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1
• Gene ID: 4316
• mRNA Refseq: NM_002423
• Protein Refseq: NP_002414
• MIM: 178990
• UniProt ID: P09237