Recombinant Human MMP7 protein, GST-tagged
Cat.No. : | MMP7-3236H |
Product Overview : | Recombinant Human MMP7 protein(P09237)(95-267aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 95-267aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ] |
Official Symbol | MMP7 |
Synonyms | MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1; |
Gene ID | 4316 |
mRNA Refseq | NM_002423 |
Protein Refseq | NP_002414 |
MIM | 178990 |
UniProt ID | P09237 |
◆ Recombinant Proteins | ||
MMP7-5435H | Recombinant Human MMP7 Protein, GST-tagged | +Inquiry |
MMP7-4565H | Recombinant Human MMP7 Protein (Tyr95-Lys267), N-His tagged | +Inquiry |
MMP7-6280HF | Recombinant Full Length Human MMP7 Protein, GST-tagged | +Inquiry |
MMP7-001H | Recombinant Human MMP7 Protein, His-tagged | +Inquiry |
MMP7-3236H | Recombinant Human MMP7 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP7-28205TH | Native Human MMP7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP7-2883HCL | Recombinant Human MMP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP7 Products
Required fields are marked with *
My Review for All MMP7 Products
Required fields are marked with *
0
Inquiry Basket