Recombinant Human MMP21 Protein, GST-tagged

• Cat.No.: MMP21-5427H
• Product Overview: Human MMP21 partial ORF ( NP_671724.1, 374 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the matrix metalloproteinase family. Proteins in this family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction, and tissue remodeling,and disease processes, such as asthma and metastasis. The encoded protein may play an important role in embryogenesis, particularly in neuronal cells, as well as in lymphocyte development and survival. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.62 kDa
• AA Sequence: TRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MMP21 matrix metallopeptidase 21 [ Homo sapiens ]
• Official Symbol: MMP21
• Synonyms: MMP21; matrix metallopeptidase 21; matrix metalloproteinase 21; matrix metalloproteinase-21; MMP-21
• Gene ID: 118856
• mRNA Refseq: NM_147191
• Protein Refseq: NP_671724
• MIM: 608416
• UniProt ID: Q8N119