Recombinant Human MMP19 Protein, GST-tagged

Cat.No. : MMP19-5424H
Product Overview : Human MMP19 full-length ORF ( NP_002420.1, 1 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This protein is expressed in human epidermis and it has a role in cellular proliferation as well as migration and adhesion to type I collagen. Multiple transcript variants encoding distict isoforms have been identified for this gene. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 83.8 kDa
AA Sequence : MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMP19 matrix metallopeptidase 19 [ Homo sapiens ]
Official Symbol MMP19
Synonyms MMP19; matrix metallopeptidase 19; matrix metalloproteinase 19 , MMP18; matrix metalloproteinase-19; RASI 1; MMP-18; MMP-19; matrix metalloproteinase 18; matrix metalloproteinase 19; matrix metalloproteinase-18; matrix metalloproteinase RASI; MMP18; RASI-1;
Gene ID 4327
mRNA Refseq NM_002429
Protein Refseq NP_002420
MIM 601807
UniProt ID Q99542

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMP19 Products

Required fields are marked with *

My Review for All MMP19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon