Recombinant Human MMP14 protein
Cat.No. : | MMP14-84H |
Product Overview : | Recombinant Human MMP14 protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 264 |
Description : | As the first member of membrane type (MT) MMPs, MMP-14, also known as MT1-MMP, plays an important role in extracellular matrix (ECM) remodeling by being able to degrade type I collagen, activate pro-MMP-2 and process cell adhesion molecules such as CD44 and integrin alpha V. MMP-14 is therefore a key enzyme in many physiological and pathological processes such as angiogenesis and tumor invasion. Structurally, MMP-14 consists of the following domains: a pro domain containing the furin cleavage site, a catalytic domain containing the zinc-binding site, a hinge region, a hemopexin-like domain, a transmembrane domain, and a cytoplamasic tail. Recombinant Human MMP-14 consists of the pro and catalytic domains, which can be activated by treatment with furin as described in Activity Assay Protocol. |
Form : | Supplied as a 0.2 μm filtered solution in 20 mM Tris-HCl, pH 7.4, 300 mM NaCl, 3 mM CaCl2,10 μM ZnCl2, with 30 % glycerol. |
Molecular Mass : | Approximately 29.6 kDa, a single non-glycosylated polypeptide chain containing 264 amino acids. |
AA Sequence : | ALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYG |
Endotoxin : | Less than 1 EU/µg of rHuMMP-14 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | MMP14 |
Official Symbol | MMP14 |
Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1; |
Gene ID | 4323 |
mRNA Refseq | NM_004995 |
Protein Refseq | NP_004986 |
MIM | 600754 |
UniProt ID | P50281 |
◆ Recombinant Proteins | ||
MMP14-3713R | Recombinant Rat MMP14 Protein | +Inquiry |
RFL2938MF | Recombinant Full Length Mouse Matrix Metalloproteinase-14(Mmp14) Protein, His-Tagged | +Inquiry |
MMP14-1837H | Active Recombinant Human MMP14 protein | +Inquiry |
MMP14-33H | Active Recombinant Human MMP14 protein, mutation C127S | +Inquiry |
MMP14-2790R | Recombinant Rhesus monkey MMP14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP14 Products
Required fields are marked with *
My Review for All MMP14 Products
Required fields are marked with *
0
Inquiry Basket