Recombinant Human MMAB, His-tagged

• Cat.No.: MMAB-27647TH
• Product Overview: Recombinant full length Human MMAB with an N terminal His tag; 239 amino acids with tag, Predicted MWt 26.3 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 218 amino acids
• Description: This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (Ad°Cbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found.
• Conjugation: HIS
• Molecular Weight: 26.300kDa inclusive of tags
• Tissue specificity: Expressed in liver and skeletal muscle.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL
• Sequence Similarities: Belongs to the Cob(I)alamin adenosyltransferase family.

Gene Information

• Gene Name: MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ]
• Official Symbol: MMAB
• Synonyms: MMAB; methylmalonic aciduria (cobalamin deficiency) cblB type; methylmalonic aciduria (cobalamin deficiency) type B; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; cblB
• Gene ID: 326625
• mRNA Refseq: NM_052845
• Protein Refseq: NP_443077
• MIM: 607568
• Uniprot ID: Q96EY8
• Chromosome Location: 12q24
• Pathway: Metabolic pathways, organism-specific biosystem; Porphyrin and chlorophyll metabolism, organism-specific biosystem; Porphyrin and chlorophyll metabolism, conserved biosystem
• Function: ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; nucleotide binding; transferase activity