Recombinant Human MLLT11 Protein, GST-tagged
Cat.No. : | MLLT11-399H |
Product Overview : | Human AF1Q full-length ORF ( AAH09624, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLLT11 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 [ Homo sapiens ] |
Official Symbol | MLLT11 |
Synonyms | MLLT11; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11; protein AF1q; AF1Q; ALL1 fused gene from chromosome 1q; ALL1-fused gene from chromosome 1q; RP11-316M1.10; |
Gene ID | 10962 |
mRNA Refseq | NM_006818 |
Protein Refseq | NP_006809 |
MIM | 604684 |
UniProt ID | Q13015 |
◆ Recombinant Proteins | ||
MLLT11-3702R | Recombinant Rat MLLT11 Protein | +Inquiry |
MLLT11-9886M | Recombinant Mouse MLLT11 Protein | +Inquiry |
MLLT11-5585M | Recombinant Mouse MLLT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLLT11-986HF | Recombinant Full Length Human MLLT11 Protein, GST-tagged | +Inquiry |
MLLT11-206H | Recombinant Human MLLT11 protein, T7/His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLLT11 Products
Required fields are marked with *
My Review for All MLLT11 Products
Required fields are marked with *
0
Inquiry Basket