Recombinant Human MLF2 Protein, GST-tagged

• Cat.No.: MLF2-5384H
• Product Overview: Human MLF2 full-length ORF ( AAH00898, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MLF2 (Myeloid Leukemia Factor 2) is a Protein Coding gene. Diseases associated with MLF2 include Myeloid Leukemia and Leukemia. An important paralog of this gene is MLF1.
• Molecular Mass: 53.02 kDa
• AA Sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MLF2 myeloid leukemia factor 2 [ Homo sapiens ]
• Official Symbol: MLF2
• Synonyms: MLF2; myeloid leukemia factor 2; NTN4; myelodysplasia-myeloid leukemia factor 2
• Gene ID: 8079
• mRNA Refseq: NM_005439
• Protein Refseq: NP_005430
• MIM: 601401
• UniProt ID: Q15773