Recombinant Human MKLN1

Cat.No. : MKLN1-30244TH
Product Overview : Recombinant fragment corresponding to amino acids 633-735 of Human Mkln1 with an N terminal proprietary tag; Predicted MWt 36.96 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
ProteinLength : 103 amino acids
Description : Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al.
Molecular Weight : 36.960kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP EETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFD TLVNFFPDSMTPPKGNLVDLITL
Gene Name MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ]
Official Symbol MKLN1
Synonyms MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2;
Gene ID 4289
mRNA Refseq NM_001145354
Protein Refseq NP_001138826
MIM 605623
Uniprot ID Q9UL63
Chromosome Location 7q32

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MKLN1 Products

Required fields are marked with *

My Review for All MKLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon