Recombinant Human MKLN1 Protein, GST-tagged

• Cat.No.: MKLN1-5364H
• Product Overview: Human MKLN1 partial ORF ( NP_037387, 633 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al., 1998 [PubMed 9724633]).[supplied by OMIM
• Molecular Mass: 37.07 kDa
• AA Sequence: RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ]
• Official Symbol: MKLN1
• Synonyms: MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2; FLJ11162
• Gene ID: 4289
• mRNA Refseq: NM_001145354
• Protein Refseq: NP_001138826
• MIM: 605623
• UniProt ID: Q9UL63