Recombinant Human MKI67 protein, His-tagged
Cat.No. : | MKI67-3225H |
Product Overview : | Recombinant Human MKI67 protein(P46013)(3120-3256aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3120-3256aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ] |
Official Symbol | MKI67 |
Synonyms | MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA; |
Gene ID | 4288 |
mRNA Refseq | NM_001145966 |
Protein Refseq | NP_001139438 |
MIM | 176741 |
UniProt ID | P46013 |
◆ Recombinant Proteins | ||
MKI67-1711HFL | Recombinant Full Length Human MKI67, Flag-tagged | +Inquiry |
MKI67-3226H | Recombinant Human MKI67 protein, His-SUMO-tagged | +Inquiry |
MKI67-2798H | Recombinant Human MKI67 Protein | +Inquiry |
MKI67-245H | Recombinant Human MKI67 protein(3120-3256aa), His-tagged | +Inquiry |
MKI67-3227H | Recombinant Human MKI67 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MKI67 Products
Required fields are marked with *
My Review for All MKI67 Products
Required fields are marked with *
0
Inquiry Basket