Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MINOS1-4890H
• Product Overview: C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
• Molecular Mass: 8.8 kDa
• AA Sequence: MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MINOS1 mitochondrial inner membrane organizing system 1 [ Homo sapiens (human) ]
• Official Symbol: MINOS1
• Synonyms: MINOS1; mitochondrial inner membrane organizing system 1; C1orf151, chromosome 1 open reading frame 151; mitochondrial inner membrane organizing system protein 1; FLJ36999; MIO10; RP5 1056L3.2; UPF0327 protein C1orf151; C1orf151; RP5-1056L3.2; FLJ75158
• Gene ID: 440574
• mRNA Refseq: NM_001032363
• Protein Refseq: NP_001027535
• MIM: 616574
• UniProt ID: Q5TGZ0