Recombinant Human MILR1 Protein, His tagged

• Cat.No.: MILR1-001H
• Product Overview: Recombinant Human MILR1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 29-131 aa
• Description: Predicted to enable transmembrane signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway; mast cell degranulation; and negative regulation of mast cell activation. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane.
• Tag: C-His
• Molecular Mass: 13 kDa
• AA Sequence: MKTNDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol
• Concentration: 0.55 mg/mL by Bradford

Gene Information

• Gene Name: MILR1 mast cell immunoglobulin like receptor 1 [ Homo sapiens (human) ]
• Official Symbol: MILR1
• Synonyms: MILR1; mast cell immunoglobulin like receptor 1; MCA32; MCA-32; C17orf60; Allergin-1; allergin-1; llergy inhibitory receptor 1; mast cell antigen 32; probable mast cell antigen 32 homolog
• Gene ID: 284021
• mRNA Refseq: NM_001085423
• Protein Refseq: NP_001078892
• UniProt ID: Q7Z6M3