Recombinant Human MIF4GD Protein, GST-tagged
Cat.No. : | MIF4GD-5338H |
Product Overview : | Human MIF4GD full-length ORF ( NP_065730.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which contains an MIF4G domain. [provided by RefSeq |
Molecular Mass : | 55.8 kDa |
AA Sequence : | MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIF4GD MIF4G domain containing [ Homo sapiens (human) ] |
Official Symbol | MIF4GD |
Synonyms | MIF4GD; MIF4G domain containing; MIFD; AD023; SLIP1; MIF4G domain-containing protein; SLBP (stem loop binding protein)-interacting protein 1; SLBP-interacting protein 1 |
Gene ID | 57409 |
mRNA Refseq | NM_001242498 |
Protein Refseq | NP_001229427 |
MIM | 612072 |
UniProt ID | A9UHW6 |
◆ Recombinant Proteins | ||
MIF4GD-3684R | Recombinant Rat MIF4GD Protein | +Inquiry |
MIF4GD-1119H | Recombinant Human MIF4GD | +Inquiry |
MIF4GD-3477H | Recombinant Human MIF4GD Protein, His (Fc)-Avi-tagged | +Inquiry |
MIF4GD-3340R | Recombinant Rat MIF4GD Protein, His (Fc)-Avi-tagged | +Inquiry |
MIF4GD-5338H | Recombinant Human MIF4GD Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF4GD-4315HCL | Recombinant Human MIF4GD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIF4GD Products
Required fields are marked with *
My Review for All MIF4GD Products
Required fields are marked with *
0
Inquiry Basket