Recombinant Human MICB Protein, GST-tagged

• Cat.No.: MICB-5326H
• Product Overview: Human MICB full-length ORF ( AAH44218.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides. [provided by RefSeq
• Molecular Mass: 64 kDa
• AA Sequence: MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MICB MHC class I polypeptide-related sequence B [ Homo sapiens ]
• Official Symbol: MICB
• Synonyms: MICB; MHC class I polypeptide-related sequence B; PERB11.2; MIC-B; MHC class I mic-B antigen; stress inducible class I homolog; MHC class I chain-related protein B; MHC class I-like molecule PERB11.2-IMX
• Gene ID: 4277
• mRNA Refseq: NM_005931
• Protein Refseq: NP_005922
• MIM: 602436
• UniProt ID: Q29980