Recombinant Human MIB2 Protein, GST-tagged

• Cat.No.: MIB2-5317H
• Product Overview: Human MIB2 partial ORF ( AAH37542, 381 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion. [provided by RefSeq, Mar 2017]
• Molecular Mass: 36.74 kDa
• AA Sequence: IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIB2 mindbomb E3 ubiquitin protein ligase 2 [ Homo sapiens ]
• Official Symbol: MIB2
• Synonyms: MIB2; mindbomb E3 ubiquitin protein ligase 2; mindbomb homolog 2 (Drosophila) , zinc finger, ZZ type with ankyrin repeat domain 1 , ZZANK1; E3 ubiquitin-protein ligase MIB2; FLJ39787; skeletrophin; ZZZ5; novelzin; mindbomb homolog 2; mind bomb homolog 2; novel zinc finger protein; putative NF-kappa-B-activating protein 002N; zinc finger, ZZ type with ankyrin repeat domain 1; zinc finger ZZ type with ankyrin repeat domain protein 1; ZZANK1; FLJ20648; FLJ41406
• Gene ID: 142678
• mRNA Refseq: NM_001170686
• Protein Refseq: NP_001164157
• MIM: 611141
• UniProt ID: Q96AX9