Recombinant Human MGAT5 Protein, GST-tagged

• Cat.No.: MGAT5-4363H
• Product Overview: Human MGAT5 partial ORF ( NP_002401, 642 a.a. - 739 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded proteins activity may correlate with the progression of invasive malignancies. [provided by RefSeq
• Molecular Mass: 36.52 kDa
• AA Sequence: LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MGAT5 mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase [ Homo sapiens ]
• Official Symbol: MGAT5
• Synonyms: MGAT5; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A; GNT V; glcNAc-T V; N-acetylglucosaminyl-transferase V; mannoside acetylglucosaminyltransferase 5; alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase; GNT-V; GNT-VA; FLJ31899; FLJ43217; DKFZp686B24166
• Gene ID: 4249
• mRNA Refseq: NM_002410
• Protein Refseq: NP_002401
• MIM: 601774
• UniProt ID: Q09328