Recombinant Human MGAT2, His-tagged
Cat.No. : | MGAT2-92H |
Product Overview : | Recombinant Human Mannoside Acetylglucosaminyltransferase 2/MGAT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg30-Gln447) of Human MGAT2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 30-447 a.a. |
Description : | Mannoside Acetylglucosaminyltransferase 2 (MGAT2) is a single-pass type II membrane protein that contains the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain and a C-terminal catalytic domain. MGAT2 catalyzes an essential step in the conversion of oligo-mannose to complex N-glycans. Defects in MGAT2 are the cause of congenital disorder of glycosylation type 2A. |
AA Sequence : | RQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSL VYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTE INQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYRE AKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVL SLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLT VSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTV VAISPPRKNGGWGDIRDHELCKSYRRLQLDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
ARL6IP1-11334Z | Recombinant Zebrafish ARL6IP1 | +Inquiry |
YYBL-2986B | Recombinant Bacillus subtilis YYBL protein, His-tagged | +Inquiry |
FZD6-1598R | Recombinant Rhesus Macaque FZD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM70A-6221R | Recombinant Rat TOMM70A Protein | +Inquiry |
CNOT2-763R | Recombinant Rhesus Macaque CNOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-97R | Rhesus monkey Colon transverse Lysate | +Inquiry |
AIFM1-8954HCL | Recombinant Human AIFM1 293 Cell Lysate | +Inquiry |
TTC17-1853HCL | Recombinant Human TTC17 cell lysate | +Inquiry |
RBP2-533HCL | Recombinant Human RBP2 lysate | +Inquiry |
DLC1-6913HCL | Recombinant Human DLC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGAT2 Products
Required fields are marked with *
My Review for All MGAT2 Products
Required fields are marked with *
0
Inquiry Basket