Recombinant Human MGA protein, GST-tagged

• Cat.No.: MGA-301545H
• Product Overview: Recombinant Human MGA (1985-2170 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Ser1985-Gln2170
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SLEDRGDHLDEECLPEEGCATVKPSEHSCITGSHTDQDYKDVNEEYGARNRKSSKEKVAVLEVRTISEKASNKTVQNLSKVQHQKLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MGA MAX gene associated [ Homo sapiens ]
• Official Symbol: MGA
• Synonyms: MGA; MAX gene associated; MAX gene-associated protein; FLJ12634; KIAA0518; MAD5; MXD5; MAX dimerization protein 5
• Gene ID: 23269
• mRNA Refseq: NM_001080541
• Protein Refseq: NP_001074010
• UniProt ID: Q8IWI9