Recombinant Human MFN2 Protein, GST-tagged

• Cat.No.: MFN2-4380H
• Product Overview: Human MFN2 partial ORF ( NP_055689, 661 a.a. - 757 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq
• Molecular Mass: 36.41 kDa
• AA Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MFN2 mitofusin 2 [ Homo sapiens ]
• Official Symbol: MFN2
• Synonyms: MFN2; mitofusin 2; mitofusin-2; CMT2A2; CPRP1; KIAA0214; MARF; hyperplasia suppressor; transmembrane GTPase MFN2; mitochondrial assembly regulatory factor; HSG; CMT2A
• Gene ID: 9927
• mRNA Refseq: NM_001127660
• Protein Refseq: NP_001121132
• MIM: 608507
• UniProt ID: O95140