Recombinant Human MFN2 Protein, GST-tagged

Cat.No. : MFN2-4380H
Product Overview : Human MFN2 partial ORF ( NP_055689, 661 a.a. - 757 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq
Molecular Mass : 36.41 kDa
AA Sequence : FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MFN2 mitofusin 2 [ Homo sapiens ]
Official Symbol MFN2
Synonyms MFN2; mitofusin 2; mitofusin-2; CMT2A2; CPRP1; KIAA0214; MARF; hyperplasia suppressor; transmembrane GTPase MFN2; mitochondrial assembly regulatory factor; HSG; CMT2A;
Gene ID 9927
mRNA Refseq NM_001127660
Protein Refseq NP_001121132
MIM 608507
UniProt ID O95140

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MFN2 Products

Required fields are marked with *

My Review for All MFN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon