Recombinant Human MFAP3 Protein, GST-tagged

• Cat.No.: MFAP3-4391H
• Product Overview: Human MFAP3 full-length ORF ( NP_005918.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MFAP3 (Microfibril Associated Protein 3) is a Protein Coding gene. Among its related pathways are Elastic fibre formation and Degradation of the extracellular matrix. An important paralog of this gene is MFAP3L.
• Molecular Mass: 66.6 kDa
• AA Sequence: MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MFAP3 microfibrillar-associated protein 3 [ Homo sapiens ]
• Official Symbol: MFAP3
• Synonyms: MFAP3; microfibrillar-associated protein 3; microfibril-associated glycoprotein 3; DKFZp586F0219
• Gene ID: 4238
• mRNA Refseq: NM_001135037
• Protein Refseq: NP_001128509
• MIM: 600491
• UniProt ID: P55082