Recombinant Human METTL7B Protein, GST-tagged

• Cat.No.: METTL7B-4398H
• Product Overview: Human METTL7B full-length ORF ( NP_689850.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: METTL7B (Methyltransferase Like 7B) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. An important paralog of this gene is METTL7A.
• Molecular Mass: 48.5 kDa
• AA Sequence: MESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL7B methyltransferase like 7B [ Homo sapiens ]
• Official Symbol: METTL7B
• Synonyms: METTL7B; methyltransferase like 7B; methyltransferase-like protein 7B; MGC17301
• Gene ID: 196410
• mRNA Refseq: NM_152637
• Protein Refseq: NP_689850
• UniProt ID: Q6UX53