Recombinant Human METTL7B Protein, GST-tagged

Cat.No. : METTL7B-4398H
Product Overview : Human METTL7B full-length ORF ( NP_689850.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : METTL7B (Methyltransferase Like 7B) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. An important paralog of this gene is METTL7A.
Molecular Mass : 48.5 kDa
AA Sequence : MESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL7B methyltransferase like 7B [ Homo sapiens ]
Official Symbol METTL7B
Synonyms METTL7B; methyltransferase like 7B; methyltransferase-like protein 7B; MGC17301;
Gene ID 196410
mRNA Refseq NM_152637
Protein Refseq NP_689850
UniProt ID Q6UX53

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All METTL7B Products

Required fields are marked with *

My Review for All METTL7B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon