Recombinant Human METTL2B Protein, GST-tagged

• Cat.No.: METTL2B-4406H
• Product Overview: Human METTL2 partial ORF ( NP_060866.1, 41 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
• Molecular Mass: 33.22 kDa
• AA Sequence: SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL2B methyltransferase like 2B [ Homo sapiens ]
• Official Symbol: METTL2B
• Synonyms: METTL2B; methyltransferase like 2B; methyltransferase like 2 , METTL2; methyltransferase-like protein 2B; FLJ11350; METL; METTL2; METTL2A; PSENIP1; FLJ12760
• Gene ID: 55798
• mRNA Refseq: NM_018396
• Protein Refseq: NP_060866
• MIM: 607846
• UniProt ID: Q6P1Q9