Recombinant Human METTL25 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | METTL25-2627H |
Product Overview : | C12orf26 MS Standard C13 and N15-labeled recombinant protein (NP_115606) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Contaminating sequence. Potential poly-A sequence.. |
Molecular Mass : | 68.2 kDa |
AA Sequence : | MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLVEAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVKNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKKLGLDESKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALKKQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | METTL25 methyltransferase like 25 [ Homo sapiens (human) ] |
Official Symbol | METTL25 |
Synonyms | METTL25; methyltransferase like 25; C12orf26; methyltransferase-like protein 25 |
Gene ID | 84190 |
mRNA Refseq | NM_032230 |
Protein Refseq | NP_115606 |
UniProt ID | Q8N6Q8 |
◆ Recombinant Proteins | ||
METTL25-2021HF | Recombinant Full Length Human METTL25 Protein, GST-tagged | +Inquiry |
METTL25-495H | Recombinant Human METTL25 Protein, GST-tagged | +Inquiry |
METTL25-7574H | Recombinant Human METTL25 protein, His&Myc-tagged | +Inquiry |
METTL25-2627H | Recombinant Human METTL25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mettl25-4045M | Recombinant Mouse Mettl25 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL25-8326HCL | Recombinant Human C12orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL25 Products
Required fields are marked with *
My Review for All METTL25 Products
Required fields are marked with *
0
Inquiry Basket