Recombinant Human METAP1D, His-tagged

• Cat.No.: METAP1D-139H
• Product Overview: Recombinant Human Methionine Aminopeptidase 1D Mitochondrial/METAP1D is produced with our E. coli expression system. The target protein is expressed with sequence (Arg44-Ala335) of Human METAP1D fused with a 6His tag at both the N-terminus and C-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 44-335 a.a.
• Description: Methionine Aminopeptidase 1D (METAP1D) is a mitochondrion protein that belongs to the peptidase M24A family. METAP1D is overexpressed at the protein level in colon cancer cell lines and colon tumors as compared to normal tissues. N-terminal methionine removal is an important cellular process required for proper biological activity, subcellular localization, and eventual degradation of many proteins. METAP1D is also active with zinc, manganese or divalent ions. It may also play an important role in colon tumorigenesis.
• Form: Supplied as a 0.2 μM filtered solution of 50mM Tris, 100mM NaCl, pH 8.0
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIE VKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVC TSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEA IAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFT IEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEALEHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: METAP1D methionyl aminopeptidase type 1D (mitochondrial) [ Homo sapiens ]
• Official Symbol: METAP1D
• Synonyms: METAP1D; methionyl aminopeptidase type 1D (mitochondrial); methionine aminopeptidase 1D, mitochondrial; MAP1D; Metap1l; methionine aminopeptidase 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial
• Gene ID: 254042
• mRNA Refseq: NM_199227
• Protein Refseq: NP_954697
• MIM: 610267
• UniProt ID: Q6UB28
• Chromosome Location: 2q31.1
• Function: aminopeptidase activity; metal ion binding; metalloexopeptidase activity; peptidase activity