Recombinant Human methionyl aminopeptidase type 1D, mitochondrial protein, His tagged

• Cat.No.: METAP1D-2468H
• Product Overview: Recombinant Human METAP1D protein (44-335aa) with His tag was expressed in Baculovirus-Insect Cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• ProteinLength: 44-335aa
• Description: The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18) (Serero et al., 2003 [PubMed 14532271]).
• Tag: C-His
• Molecular Mass: 33 kDa
• AA Sequence: MRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEAHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: METAP1D methionyl aminopeptidase type 1D, mitochondrial [ Homo sapiens (human) ]
• Official Symbol: METAP1D
• Synonyms: METAP1D; methionyl aminopeptidase type 1D (mitochondrial); methionine aminopeptidase 1D, mitochondrial; MAP1D; Metap1l; methionine aminopeptidase 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial
• Gene ID: 254042
• mRNA Refseq: NM_199227
• Protein Refseq: NP_954697
• MIM: 610267
• UniProt ID: Q6UB28