Recombinant Human methionyl aminopeptidase type 1D, mitochondrial protein, His tagged

Cat.No. : METAP1D-2468H
Product Overview : Recombinant Human METAP1D protein (44-335aa) with His tag was expressed in Baculovirus-Insect Cells.
Availability April 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 44-335aa
Description : The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18) (Serero et al., 2003 [PubMed 14532271]).
Tag : C-His
Molecular Mass : 33 kDa
AA Sequence : MRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEAHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL by BCA
Gene Name METAP1D methionyl aminopeptidase type 1D, mitochondrial [ Homo sapiens (human) ]
Official Symbol METAP1D
Synonyms METAP1D; methionyl aminopeptidase type 1D (mitochondrial); methionine aminopeptidase 1D, mitochondrial; MAP1D; Metap1l; methionine aminopeptidase 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial
Gene ID 254042
mRNA Refseq NM_199227
Protein Refseq NP_954697
MIM 610267
UniProt ID Q6UB28

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All METAP1D Products

Required fields are marked with *

My Review for All METAP1D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon