Recombinant Human MET Protein, GST-tagged
Cat.No. : | MET-4419H |
Product Overview : | Human MET partial ORF ( NM_000245, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The proto-oncogene MET product is the hepatocyte growth factor receptor and encodes tyrosine-kinase activity. The primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor. Various mutations in the MET gene are associated with papillary renal carcinoma. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MET met proto-oncogene (hepatocyte growth factor receptor) [ Homo sapiens ] |
Official Symbol | MET |
Synonyms | MET; met proto-oncogene (hepatocyte growth factor receptor); hepatocyte growth factor receptor; HGFR; RCCP2; SF receptor; HGF receptor; oncogene MET; HGF/SF receptor; proto-oncogene c-Met; scatter factor receptor; tyrosine-protein kinase Met; met proto-oncogene tyrosine kinase; AUTS9; c-Met; |
Gene ID | 4233 |
mRNA Refseq | NM_000245 |
Protein Refseq | NP_000236 |
MIM | 164860 |
UniProt ID | P08581 |
◆ Recombinant Proteins | ||
Met-31HAF488 | Recombinant Human Met Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
MET-02H | Active Recombinant Human MET Protein, His-tagged | +Inquiry |
MET-7295H | Recombinant Human MET, His & GST tagged | +Inquiry |
MET-35H | Active Recombinant Human MET Protein, GST-tagged | +Inquiry |
Met-4061MP | Recombinant Mouse Met protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MET-001CCL | Recombinant Cynomolgus MET cell lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
MET-2529HCL | Recombinant Human MET cell lysate | +Inquiry |
MET-1054RCL | Recombinant Rat MET cell lysate | +Inquiry |
MET-001HCL | Recombinant Human MET cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MET Products
Required fields are marked with *
My Review for All MET Products
Required fields are marked with *
0
Inquiry Basket