Recombinant Human MERTK Protein, GST-tagged

• Cat.No.: MERTK-4436H
• Product Overview: Human MERTK partial ORF ( NP_006334, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP). [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MERTK c-mer proto-oncogene tyrosine kinase [ Homo sapiens ]
• Official Symbol: MERTK
• Synonyms: MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; mer; RP38; STK kinase; proto-oncogene c-Mer; MER receptor tyrosine kinase; receptor tyrosine kinase MerTK; MER; c-mer; MGC133349
• Gene ID: 10461
• mRNA Refseq: NM_006343
• Protein Refseq: NP_006334
• MIM: 604705
• UniProt ID: Q12866