Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MEIS3-4499H
• Product Overview: MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_001009813) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells.
• Molecular Mass: 39.1 kDa
• AA Sequence: MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MEIS3 Meis homeobox 3 [ Homo sapiens (human) ]
• Official Symbol: MEIS3
• Synonyms: MEIS3; Meis homeobox 3; Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse); homeobox protein Meis3; DKFZp547H236; MRG2; meis1-related protein 2; Meis1, myeloid ecotropic viral integration site 1 homolog 3
• Gene ID: 56917
• mRNA Refseq: NM_001009813
• Protein Refseq: NP_001009813
• UniProt ID: Q99687