Recombinant Human MEIS3 Protein, GST-tagged
Cat.No. : | MEIS3-4450H |
Product Overview : | Human MEIS3 full-length ORF ( AAH25404, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 72.05 kDa |
AA Sequence : | MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MEIS3 Meis homeobox 3 [ Homo sapiens ] |
Official Symbol | MEIS3 |
Synonyms | MEIS3; Meis homeobox 3; Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse); homeobox protein Meis3; DKFZp547H236; MRG2; meis1-related protein 2; Meis1, myeloid ecotropic viral integration site 1 homolog 3; |
Gene ID | 56917 |
mRNA Refseq | NM_001009813 |
Protein Refseq | NP_001009813 |
UniProt ID | Q99687 |
◆ Recombinant Proteins | ||
MEIS3-4499H | Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MEIS3-5472M | Recombinant Mouse MEIS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEIS3-4450H | Recombinant Human MEIS3 Protein, GST-tagged | +Inquiry |
MEIS3-1774H | Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MEIS3-6128HF | Recombinant Full Length Human MEIS3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEIS3-4369HCL | Recombinant Human MEIS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEIS3 Products
Required fields are marked with *
My Review for All MEIS3 Products
Required fields are marked with *
0
Inquiry Basket