Recombinant Full Length Human MEIS3 Protein, GST-tagged

• Cat.No.: MEIS3-6128HF
• Product Overview: Human MEIS3 full-length ORF ( AAH25404, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 421 amino acids
• Description: This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. [provided by RefSeq, Sep 2016]
• Molecular Mass: 72.05 kDa
• AA Sequence: MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEIS3 Meis homeobox 3 [ Homo sapiens ]
• Official Symbol: MEIS3
• Synonyms: MEIS3; Meis homeobox 3; Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse); homeobox protein Meis3; DKFZp547H236; MRG2; meis1-related protein 2; Meis1, myeloid ecotropic viral integration site 1 homolog 3
• Gene ID: 56917
• mRNA Refseq: NM_001009813
• Protein Refseq: NP_001009813
• MIM: 619443
• UniProt ID: Q99687