Recombinant Human MEI1 Protein, GST-tagged

• Cat.No.: MEI1-4453H
• Product Overview: Human MEI1 full-length ORF ( AAH32248.1, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MEI1 (Meiotic Double-Stranded Break Formation Protein 1) is a Protein Coding gene. GO annotations related to this gene include binding.
• Molecular Mass: 52 kDa
• AA Sequence: MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEI1 meiosis inhibitor 1 [ Homo sapiens ]
• Official Symbol: MEI1
• Synonyms: MEI1; meiosis inhibitor 1; meiosis inhibitor protein 1; MGC40042; meiosis defective 1; meiosis defective protein 1
• Gene ID: 150365
• mRNA Refseq: NM_152513
• Protein Refseq: NP_689726
• MIM: 608797
• UniProt ID: Q5TIA1