Recombinant Human MEFV Protein, GST-tagged

Cat.No. : MEFV-4454H
Product Overview : Human MEFV partial ORF ( NP_000234, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MEFV Mediterranean fever [ Homo sapiens ]
Official Symbol MEFV
Synonyms MEFV; Mediterranean fever; MEF; pyrin; FMF; TRIM20; marenostrin; MGC126560; MGC126586;
Gene ID 4210
mRNA Refseq NM_000243
Protein Refseq NP_000234
MIM 608107
UniProt ID O15553

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MEFV Products

Required fields are marked with *

My Review for All MEFV Products

Required fields are marked with *

0

Inquiry Basket

cartIcon