Recombinant Human MEF2D protein, GST-tagged

• Cat.No.: MEF2D-820H
• Product Overview: Recombinant Human MEF2D(256 a.a. - 351 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 256 a.a. - 351 a.a.
• Description: This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.19 kDa
• AA Sequence: THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: MEF2D myocyte enhancer factor 2D [ Homo sapiens ]
• Official Symbol: MEF2D
• Synonyms: MEF2D; myocyte enhancer factor 2D; myocyte-specific enhancer factor 2D; MEF2D/DAZAP1 fusion; MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancer factor 2D); myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusion protein; DKFZp686I1536
• Gene ID: 4209
• mRNA Refseq: NM_005920
• Protein Refseq: NP_005911
• MIM: 600663
• UniProt ID: Q14814
• Chromosome Location: 1q12-q23
• Pathway: Adipogenesis, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Myogenesis, organism-specific biosystem; Role of Calcineurin-dependent NFAT signaling in lymphocytes, organism-specific biosystem
• Function: DNA binding; RNA polymerase II regulatory region sequence-specific DNA binding; activating transcription factor binding; histone deacetylase binding; protein binding; protein dimerization activity; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding RNA polymerase II transcription factor activity; sequence-specific DNA binding transcription factor activity