Recombinant Human MEF2D protein, GST-tagged
Cat.No. : | MEF2D-818H |
Product Overview : | Recombinant Human MEF2D protein(165-514 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 165-514 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK |
Gene Name | MEF2D myocyte enhancer factor 2D [ Homo sapiens ] |
Official Symbol | MEF2D |
Synonyms | MEF2D; myocyte enhancer factor 2D; myocyte-specific enhancer factor 2D; MEF2D/DAZAP1 fusion; MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancer factor 2D); myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusion protein; DKFZp686I1536; |
Gene ID | 4209 |
mRNA Refseq | NM_005920 |
Protein Refseq | NP_005911 |
MIM | 600663 |
UniProt ID | Q14814 |
◆ Recombinant Proteins | ||
MEF2D-818H | Recombinant Human MEF2D protein, GST-tagged | +Inquiry |
MEF2D-817H | Recombinant Human MEF2D, His-tagged | +Inquiry |
MEF2D-3641R | Recombinant Rat MEF2D Protein | +Inquiry |
MEF2D-3297R | Recombinant Rat MEF2D Protein, His (Fc)-Avi-tagged | +Inquiry |
MEF2D-8904Z | Recombinant Zebrafish MEF2D | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2D-4374HCL | Recombinant Human MEF2D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEF2D Products
Required fields are marked with *
My Review for All MEF2D Products
Required fields are marked with *
0
Inquiry Basket