Recombinant Human MEF2B Protein, GST-tagged

• Cat.No.: MEF2B-4458H
• Product Overview: Human MEF2B partial ORF (NP_005910.1, 165 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq
• Molecular Mass: 33.44 kDa
• AA Sequence: SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEF2B myocyte enhancer factor 2B [ Homo sapiens ]
• Official Symbol: MEF2B
• Synonyms: MEF2B; myocyte enhancer factor 2B; myocyte-specific enhancer factor 2B; RSRFR2; serum response factor-like protein 2; MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B); FLJ32648
• Gene ID: 100271849
• mRNA Refseq: NM_001145785
• Protein Refseq: NP_001139257
• MIM: 600661
• UniProt ID: Q02080