Recombinant Human MED23 Protein, GST-tagged

• Cat.No.: MED23-1906H
• Product Overview: Human CRSP3 partial ORF ( NP_004821, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein also acts as a metastasis suppressor. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2012]
• Molecular Mass: 36.74 kDa
• AA Sequence: LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED23 mediator complex subunit 23 [ Homo sapiens ]
• Official Symbol: MED23
• Synonyms: MED23; mediator complex subunit 23; cofactor required for Sp1 transcriptional activation, subunit 3, 130kDa , CRSP3; mediator of RNA polymerase II transcription subunit 23; CRSP130; DRIP130; Sur2; 130 kDa transcriptional co-activator; 133 kDa transcriptional co-activator; vitamin D3 receptor interacting protein; activator-recruited cofactor 130 kDa component; cofactor required for Sp1 transcriptional activation subunit 3; SUR2; CRSP3; MRT18; SUR-2; ARC130; CRSP133; DKFZp434H0117
• Gene ID: 9439
• mRNA Refseq: NM_004830
• Protein Refseq: NP_004821
• MIM: 605042
• UniProt ID: Q9ULK4