Recombinant Human MED12 Protein, GST-tagged

• Cat.No.: MED12-4479H
• Product Overview: Human MED12 partial ORF ( NP_005111, 1829 a.a. - 1941 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. [provided by RefSeq
• Molecular Mass: 38.17 kDa
• AA Sequence: QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED12 mediator complex subunit 12 [ Homo sapiens ]
• Official Symbol: MED12
• Synonyms: MED12; mediator complex subunit 12; FG syndrome 1 , FGS1, mediator of RNA polymerase II transcription, subunit 12 homolog (S. cerevisiae) , TNRC11, trinucleotide repeat containing 11 (THR associated protein, 230kDa subunit); mediator of RNA polymerase II transcription subunit 12; CAGH45; HOPA; KIAA0192; OKS; OPA1; TRAP230; CAG repeat protein 45; human opposite paired; OPA-containing protein; putative mediator subunit 12; activator-recruited cofactor 240 kDa component; trinucleotide repeat-containing gene 11 protein; thyroid hormone receptor-associated protein, 230 kDa subunit; mediator of RNA polymerase II transcription, subunit 12 homolog; thyroid hormone receptor-associated protein complex 230 kDa component; trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subunit); FGS1; ARC240; MED12S; TNRC11
• Gene ID: 9968
• mRNA Refseq: NM_005120
• Protein Refseq: NP_005111
• MIM: 300188
• UniProt ID: Q93074