Recombinant Human MECP2

Cat.No. : MECP2-27384TH
Product Overview : Recombinant fragment corresponding to amino acids 81-170 of Human MeCP2 with a proprietary tag; Predicted MWt 35.53 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Present in all adult somatic tissues tested.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
Sequence Similarities : Contains 2 A.T hook DNA-binding domains.Contains 1 MBD (methyl-CpG-binding) domain.
Gene Name MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ]
Official Symbol MECP2
Synonyms MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2;
Gene ID 4204
mRNA Refseq NM_001110792
Protein Refseq NP_001104262
MIM 300005
Uniprot ID P51608
Chromosome Location Xq28
Function DNA binding; double-stranded methylated DNA binding; protein N-terminus binding; protein binding; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MECP2 Products

Required fields are marked with *

My Review for All MECP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon