Recombinant Human MECP2

• Cat.No.: MECP2-27384TH
• Product Overview: Recombinant fragment corresponding to amino acids 81-170 of Human MeCP2 with a proprietary tag; Predicted MWt 35.53 kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 90 amino acids
• Description: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.
• Molecular Weight: 35.530kDa inclusive of tags
• Tissue specificity: Present in all adult somatic tissues tested.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
• Sequence Similarities: Contains 2 A.T hook DNA-binding domains.Contains 1 MBD (methyl-CpG-binding) domain.

Gene Information

• Gene Name: MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ]
• Official Symbol: MECP2
• Synonyms: MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2
• Gene ID: 4204
• mRNA Refseq: NM_001110792
• Protein Refseq: NP_001104262
• MIM: 300005
• Uniprot ID: P51608
• Chromosome Location: Xq28
• Function: DNA binding; double-stranded methylated DNA binding; protein N-terminus binding; protein binding; protein domain specific binding