Recombinant Human MDM4

Cat.No. : MDM4-27382TH
Product Overview : Recombinant fragment of Human MDMX with N terminal proprietary tag; predicted MWt 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latters degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Expressed in all tissues tested with high levels in thymus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTC FHCARRLKKAGASCPICKKEIQLVIKVFIA
Sequence Similarities : Belongs to the MDM2/MDM4 family.Contains 1 RanBP2-type zinc finger.Contains 1 RING-type zinc finger.Contains 1 SWIB domain.
Gene Name MDM4 Mdm4 p53 binding protein homolog (mouse) [ Homo sapiens ]
Official Symbol MDM4
Synonyms MDM4; Mdm4 p53 binding protein homolog (mouse); Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse) , mouse double minute 4, human homolog of; p53 binding protein; protein Mdm4; MDMX;
Gene ID 4194
mRNA Refseq NM_001204171
Protein Refseq NP_001191100
MIM 602704
Uniprot ID O15151
Chromosome Location 1q32
Pathway p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem;
Function enzyme binding; metal ion binding; protein binding; zinc ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MDM4 Products

Required fields are marked with *

My Review for All MDM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon