Recombinant Human MCM4, His-tagged

Cat.No. : MCM4-28040TH
Product Overview : Recombinant fragment, corresponding to amino acids 545-863 of Human MCM4 with N terminal His tag; 319 amino acids, 37kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 545-863 a.a.
Description : The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTR SVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIES QWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLI RLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRT GIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTP ALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLT VTGKTVRLL
Sequence Similarities : Belongs to the MCM family.Contains 1 MCM domain.
Gene Name MCM4 minichromosome maintenance complex component 4 [ Homo sapiens ]
Official Symbol MCM4
Synonyms MCM4; minichromosome maintenance complex component 4; CDC21, MCM4 minichromosome maintenance deficient 4 (S. cerevisiae); DNA replication licensing factor MCM4; CDC54; hCdc21; MGC33310; P1 Cdc21;
Gene ID 4173
mRNA Refseq NM_005914
Protein Refseq NP_005905
MIM 602638
Uniprot ID P33991
Chromosome Location 8q12-q13
Pathway Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem;
Function ATP binding; contributes_to ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MCM4 Products

Required fields are marked with *

My Review for All MCM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon