Recombinant Human MCM4, His-tagged

• Cat.No.: MCM4-28040TH
• Product Overview: Recombinant fragment, corresponding to amino acids 545-863 of Human MCM4 with N terminal His tag; 319 amino acids, 37kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 545-863 a.a.
• Description: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 87 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTR SVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIES QWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLI RLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRT GIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTP ALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLT VTGKTVRLL
• Sequence Similarities: Belongs to the MCM family.Contains 1 MCM domain.

Gene Information

• Gene Name: MCM4 minichromosome maintenance complex component 4 [ Homo sapiens ]
• Official Symbol: MCM4
• Synonyms: MCM4; minichromosome maintenance complex component 4; CDC21, MCM4 minichromosome maintenance deficient 4 (S. cerevisiae); DNA replication licensing factor MCM4; CDC54; hCdc21; MGC33310; P1 Cdc21
• Gene ID: 4173
• mRNA Refseq: NM_005914
• Protein Refseq: NP_005905
• MIM: 602638
• Uniprot ID: P33991
• Chromosome Location: 8q12-q13
• Pathway: Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem
• Function: ATP binding; contributes_to ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity