Recombinant Human MCCD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MCCD1-1978H
• Product Overview: MCCD1 MS Standard C13 and N15-labeled recombinant protein (NP_001011700) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: MCCD1 (Mitochondrial Coiled-Coil Domain 1) is a Protein Coding gene.
• Molecular Mass: 13.3 kDa
• AA Sequence: MVLPLPWLSRYHFLRLLLPSWSLAPQGSHGCCSQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQMRRHQESLGGGATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MCCD1 mitochondrial coiled-coil domain 1 [ Homo sapiens (human) ]
• Official Symbol: MCCD1
• Synonyms: MCCD1; mitochondrial coiled-coil domain 1; mitochondrial coiled-coil domain protein 1
• Gene ID: 401250
• mRNA Refseq: NM_001011700
• Protein Refseq: NP_001011700
• MIM: 609624
• UniProt ID: P59942