Recombinant Human MBNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MBNL1-6452H
Product Overview : MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997176) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities.
Molecular Mass : 41.6 kDa
AA Sequence : MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MBNL1 muscleblind-like splicing regulator 1 [ Homo sapiens (human) ]
Official Symbol MBNL1
Synonyms MBNL1; muscleblind-like splicing regulator 1; MBNL, muscleblind (Drosophila) like, muscleblind like (Drosophila); muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; triplet-expansion RNA-binding protein; MBNL; DKFZp686P06174;
Gene ID 4154
mRNA Refseq NM_207293
Protein Refseq NP_997176
MIM 606516
UniProt ID Q9NR56

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MBNL1 Products

Required fields are marked with *

My Review for All MBNL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon