Recombinant Human MBNL1 protein, His-tagged
Cat.No. : | MBNL1-6554H |
Product Overview : | Recombinant Human MBNL1 protein(1-343 aa), fused with His tag, was expressed in E.coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-343 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MBNL1 muscleblind-like splicing regulator 1 [ Homo sapiens ] |
Official Symbol | MBNL1 |
Synonyms | MBNL1; muscleblind-like splicing regulator 1; MBNL, muscleblind (Drosophila) like , muscleblind like (Drosophila); muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; triplet-expansion RNA-binding protein; MBNL; DKFZp686P06174; |
Gene ID | 4154 |
mRNA Refseq | NM_207293 |
Protein Refseq | NP_997176 |
MIM | 606516 |
UniProt ID | Q9NR56 |
◆ Recombinant Proteins | ||
MBNL1-301HF | Recombinant Full Length Human MBNL1 Protein | +Inquiry |
MBNL1-6554H | Recombinant Human MBNL1 protein, His-tagged | +Inquiry |
MBNL1-1836HFL | Recombinant Full Length Human MBNL1, Flag-tagged | +Inquiry |
Mbnl1-3982M | Recombinant Mouse Mbnl1 Protein, Myc/DDK-tagged | +Inquiry |
MBNL1-30258TH | Recombinant Human MBNL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBNL1-4441HCL | Recombinant Human MBNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBNL1 Products
Required fields are marked with *
My Review for All MBNL1 Products
Required fields are marked with *
0
Inquiry Basket