Recombinant Human MBL2 protein(21-248 aa), C-His-tagged

• Cat.No.: MBL2-2636H
• Product Overview: Recombinant Human MBL2 protein(P11226)(21-248 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 21-248 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: MBL2 mannose-binding lectin (protein C) 2, soluble [ Homo sapiens ]
• Official Symbol: MBL2
• Synonyms: MBL2; mannose-binding lectin (protein C) 2, soluble; mannose binding lectin (protein C) 2, soluble (opsonic defect) , MBL; mannose-binding protein C; COLEC1; collectin-1; mannan-binding lectin; mannose-binding lectin 2, soluble (opsonic defect); mannose-binding lectin (protein C) 2, soluble (opsonic defect); MBL; MBP; MBP1; MBL2D; MBP-C; HSMBPC; MGC116832; MGC116833
• Gene ID: 4153
• mRNA Refseq: NM_000242
• Protein Refseq: NP_000233
• MIM: 154545
• UniProt ID: P11226