Recombinant Human MBL2 protein(21-248 aa), C-His-tagged

Cat.No. : MBL2-2636H
Product Overview : Recombinant Human MBL2 protein(P11226)(21-248 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-248 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Gene Name MBL2 mannose-binding lectin (protein C) 2, soluble [ Homo sapiens ]
Official Symbol MBL2
Synonyms MBL2; mannose-binding lectin (protein C) 2, soluble; mannose binding lectin (protein C) 2, soluble (opsonic defect) , MBL; mannose-binding protein C; COLEC1; collectin-1; mannan-binding lectin; mannose-binding lectin 2, soluble (opsonic defect); mannose-binding lectin (protein C) 2, soluble (opsonic defect); MBL; MBP; MBP1; MBL2D; MBP-C; HSMBPC; MGC116832; MGC116833;
Gene ID 4153
mRNA Refseq NM_000242
Protein Refseq NP_000233
MIM 154545
UniProt ID P11226

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MBL2 Products

Required fields are marked with *

My Review for All MBL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon